List of registered websites the 2018-01-06

Domains registered the 2018-01-06 from the 10th page


Domain name
sellvehicle.bid
samuelgunter4690.bid
southwardevangelicalism.bid
surveylines.bid
sarahswirsky3546.bid
susannewbury7275.bid
sendinn.bid
savegoods.bid
servantbikes.bid
sportlemon.bid
scaleelbow.bid
scarecrowknee.bid
sexoncam.bid
sgrf.bid
sciencestream.bid
sportspinner.bid
sclerodermaunderbrush.bid
siderbulbel.bid
starwemoji.bid
starwemojis.bid
starwemotes.bid
starwemoticons.bid
virtudownjs.bid
valentinesday.bid
visionforperfect.bid
valor-way.bid
valuetoes.bid
vnxs.bid
vdxfpuikz.bid
vehiclesale.bid
voicesheet.bid
vehiclesell.bid
vuanmzqzrvmp.bid
vehicletopuse.bid
vxoxox.bid
vagabondhighpitched.bid
videosapkss.bid
viet.bid
viralclic.bid
caixaacessomobile.bid
cosmoconso.bid
cake-eclair.bid
chriszack2550.bid
create3danimation.bid
circlerat.bid
crowdiron.bid
citono.bid
claudeharris3908.bid
curtaincanvas.bid
calhoun.bid
captionhouse.bid
cloudsecuritybianalyticserpddos.bid
cobwebgiraffe.bid
cashpayday.bid
coilletters.bid
cokfwpfycgzjvn.bid
collectiblebooksonline.bid
cft02k52qh.bid
companywoman.bid
cgcp.bid
cherriesclub.bid
childrenmemory.bid
childrenway.bid
douo.bid
discounded.bid
ddoscloudsecuritybianalyticserp.bid
dxtw.bid
disobediencesexdigitism.bid
decoh5w44e.bid
dkjgyysfincxps.bid
dohb.bid
devacplhoantrnd.bid
doingsout.bid
daily-fitnesstips.bid
dfc2oioqvp.bid
daily-healthcheck.bid
doiz.bid
dashbtc.bid
dashkrw.bid
dgkbyyrn1x.bid
dollstrousers.bid
dgo7l9oldo.bid
dooricicle.bid
dboe.bid
ddczayne.bid
dopegist.bid
diabeticnews.bid
dorispickett8639.bid
digestpureme.bid
dinnerwatch.bid
dirthair.bid
theofferservicesafe-systemperfect.bid
topnewhdmovie.bid
theofferservicesafesystemsclear.bid
theofferservicesafesystem.bid
thebestpreparedforcontentsafe.bid
thingdesign.bid
theofferservicesafe2systems.bid
theofferservicesafesystemperferct.bid
thingsgroup.bid
Home 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 End Next page
Registry Database : the most valuable domain name registration information over Internet